PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9917s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 725aa    MW: 78500.2 Da    PI: 6.2239
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9917s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.62.7e-13227288162
                          XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  Araha.9917s0006.1.p 227 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQ 288
                          678899******************************************99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-16227291IPR004827Basic-leucine zipper domain
PfamPF001703.1E-11228289IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3229289IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.75E-12231289No hitNo description
Gene3DG3DSA:1.20.5.1705.8E-17231289No hitNo description
CDDcd147041.22E-21232283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MAEPITEEQP PPPAPDPNST FPPPSDFDSI SIPPFDDHFY HSGSDHTPIG ELMSDLGFPD  60
GEFELTFDGM DDLYFPAENE SFLIPVNTSN QEQFGDFTPE SEGSGISGDC LVLPKDADKG  120
ITTSGCINRH SDDRCSGADR SLDLPTPLSS QGSGNCGSDV SVATNESSPK SRNVVVDQKV  180
KVEEAATTTS IITKRKKEID EDLTDESRNS KYRRSGEDAD ASAVTGEEDE KKKARLMRNR  240
ESAQLSRQRK KHYVEELEEK VRNMHSTITD LNGKISYFMA ENATLRQQLG GNGMCPPHLP  300
PPPMGMYPPM APMPYPWMPC PPYMVKQQGS QVPLIPIPRL KPQNPLGTSK AKKSESKKGE  360
AKTKKVASIS FLGLLFCLFL FGALAPIVNV NYGGISGAFY GNYRSNYITD QIYSQHRDRV  420
LDTSRSGAGT GVSNSNGMHC GRDSDRGARK NISATESSVP PGNGSEPLVA SLFVPRNDKL  480
VKIDGNLIIN SILASEKAVA SRKASESKER KADLVISKDY SPALPLPDVG MTEDMAKHLY  540
RSKAEKQKAL SSGSADTLKD QFKTKAANGE MQQWFREGVA GPMFSSGMCT EVFQFDVSST  600
SGAIIPASPA TNVSAEHGKN TTETDKQKNR RILRGLPIPL PGSDFNLTKE HQKNSSSKEI  660
KPASSMVVSV LVDPREGGDG DIDGMIGGPK SLSRVFVVVL LDSAKYVTYS CVLPRSGAPH  720
LVTT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881751.10.0bZIP transcription factor family protein
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLD7LGH50.0D7LGH5_ARALL; BZIP transcription factor family protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein